PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1DL_3F6454D50.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YB
Protein Properties Length: 135aa    MW: 14740.6 Da    PI: 6.5229
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1DL_3F6454D50.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB152.67.1e-481811797
                  NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                           mkk++Pan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfe+y+eplkvyl+kyre+eg++
  Traes_1DL_3F6454D50.2  1 MKKAIPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEEYIEPLKVYLQKYRETEGDS 81
                           9******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471134.02E-32190IPR009072Histone-fold
Gene3DG3DSA:1.10.20.101.4E-43186IPR009072Histone-fold
PfamPF008081.4E-21155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006155.0E-231937No hitNo description
PROSITE patternPS0068502238IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006155.0E-233856No hitNo description
PRINTSPR006155.0E-235775No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 135 aa     Download sequence    Send to blast
MKKAIPANGK IAKDAKETVQ ECVSEFISFI TSEASDKCQR EKRKTINGDD LLWAMATLGF  60
EEYIEPLKVY LQKYRETEGD SKLAGKSGDV SVKKDALGPH GGSSGTSAQG MGQQVAYNPG  120
MVYMQPQYHN GDISN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A3e-401761893NF-YB
4awl_B2e-401761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-401761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0090780.0BT009078.1 Triticum aestivum clone wkm1c.pk0002.d7:fis, full insert mRNA sequence.
GenBankGU9027860.0GU902786.1 Triticum monococcum nuclear transcription factor Y subunit B2 mRNA, partial cds.
GenBankKM0787350.0KM078735.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-A2) mRNA, complete cds.
GenBankKM0787370.0KM078737.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-D2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568278.12e-87PREDICTED: nuclear transcription factor Y subunit B
SwissprotP252092e-83NFYB_MAIZE; Nuclear transcription factor Y subunit B
TrEMBLW5AEB35e-98W5AEB3_WHEAT; Uncharacterized protein
STRINGMLOC_36879.48e-93(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53340.12e-55nuclear factor Y, subunit B10
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]